PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009798614.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 754aa    MW: 86012.4 Da    PI: 7.7073
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009798614.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR196.82.4e-3064152291
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                     fYn+YA++vGF +r+s+ ++s+r++ i +r++vCskeg++ + +++ +k rr+r ++r+gCka+l+vkk+ +gkw +tk++++HnHel+p
  XP_009798614.1  64 FYNSYARRVGFGTRVSAYRRSRRDNIISSRQLVCSKEGFNPRPDEQ-HKPRRQRIVSRVGCKAHLTVKKQASGKWAITKFVKDHNHELVP 152
                     9***************************************999999.99***************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.2E-2764152IPR004330FAR1 DNA binding domain
PfamPF105517.8E-28270360IPR018289MULE transposase domain
PROSITE profilePS5096611.09554586IPR007527Zinc finger, SWIM-type
PfamPF044342.9E-10556585IPR007527Zinc finger, SWIM-type
SMARTSM005758.4E-8561588IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MESQPLNLEN DAMEFDVGSG EEEEEEDNYK HSSSGLDSRD QCSSSDLEPY EGMEFESEQA  60
ARIFYNSYAR RVGFGTRVSA YRRSRRDNII SSRQLVCSKE GFNPRPDEQH KPRRQRIVSR  120
VGCKAHLTVK KQASGKWAIT KFVKDHNHEL VPPDQVHLLR SHRHVSGPAR SLIDTLQAAG  180
LGATRVMSVL IKQSGGINNV GFTKSDCQNY MNQTRQRTLG TGAHYILEYL KQKQAEDPGF  240
FYVVQGGPSG NIFWADSTSR MNYSYFGDTV TFDTTYRTHR FRVPFAPFIG VNHHCQPVLF  300
GCALLLNESE SSFIWLFQNW LAAMSGRHPV SITTDHDRII RSAIADVFPG ARHRFCKSNI  360
FRQVQERLSH SLQLFPIFEA EFQKCVNSPE TIEEFELCWE SLLGRYNLKD DEWLHSMYDA  420
RQHWVPIYLR DTFFGETSIA KTSDTTNSFF DGYIDASTNI HILMTRYEKA TASRHEKEVK  480
AENDTIYISP ILKTPSPMEK QAANLYTREI FLMFQRELME TLAYPATVIN DTRPDVVYQV  540
AKFGEDHKVH YVQYNVFEKK ASCSCQLFAF SGIPCKHILA VFRVKNILRL PSHYVLKRWT  600
RKAKSEVVLD EDDLGLPSSH NESFTARFEK LSLEATKYVK EGVDSENVYK VAMDALRGAS  660
KKVAAAMCST PAAPKSLDMN KAKEFNLNGN QAGCGDSCLV SQDEKILELT TAVVNATGIC  720
EAYRAKLLSI LREMEEQKLR ISLKIQSMRF NQMT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009798613.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_016475931.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
SwissprotQ9SZL80.0FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A0V0ISE90.0A0A0V0ISE9_SOLCH; Uncharacterized protein
STRINGVIT_18s0122g00530.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.10.0FAR1-related sequence 5